Bioxys

Recombinant Human Metallothionein-3(MT3)

Full list of all information from selected product

About product

Catalog number:RPC20346
Name:Recombinant Human Metallothionein-3(MT3)
Size:1 mg
Price:1599.00
Go to shop   

Extra details

Verified reactivity:Homo sapiens (Human)
Protein number:P25713
Gene number:MT3
Other name:GIFB; Short name:; GIF; Growth inhibitory factor; Metallothionein-III; Short name:; MT-III
Protein origin:E.coli
Protein region:1-68aa
Protein sequence:MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Information about sequence:Full Length
Expected molecular weight:22.92kDa
Protein purity:≥ 90%
Storage recommendation:Aliquot and store at -20°C. Minimize freezing and thawing.
Use before:1 year
Shipping requirements:Blue ice
Estimated production time:7-11 business days
Notes:For research use only. Not for diagnostic procedures.
Properties:Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source:Recombinants or rec. proteins
Group:recombinants

Other suggested products