Bioxys

Recombinant Human MORC family CW-type zinc finger protein 3(MORC3),partial

View details of this awesome product

About product

Catalog number:RPC20339
Name:Recombinant Human MORC family CW-type zinc finger protein 3(MORC3),partial
Size:1 mg
Price:2329.00
Go to shop   

Extra details

Verified reactivity:Homo sapiens (Human)
Protein number:Q14149
Gene number:MORC3
Other name:Nuclear matrix protein 21 ; Zinc finger CW-type coiled-coil domain protein 3
Protein origin:E.coli
Protein region:1-290aa
Protein sequence:MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
Information about sequence:Partial
Expected molecular weight:48.69kDa
Protein purity:≥ 90%
Storage recommendation:Aliquot and store at -20°C. Minimize freezing and thawing.
Use before:1 year
Shipping requirements:Blue ice
Estimated production time:7-11 business days
Notes:For research use only. Not for diagnostic procedures.
Description:Finger like and finger proteins are like zinc fingers small proteins with a structural motif that is characterized by the coordination of one or more zinc ions in order to stabilize the fold. Homeobox and homeodomain families.
Properties:Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source:Recombinants or rec. proteins
Group:recombinants

Other suggested products