Bioxys

Recombinant Human Retinal dehydrogenase 2(ALDH1A2)

Browse details of product

About product

Catalog number:RPC20347
Name:Recombinant Human Retinal dehydrogenase 2(ALDH1A2)
Size:500 μg
Price:1078.00
Go to shop   

Extra details

Verified reactivity:Homo sapiens (Human)
Protein number:O94788
Gene number:ALDH1A2
Other name:Aldehyde dehydrogenase family 1 member A2; Retinaldehyde-specific dehydrogenase type 2; Short name:; RALDH(II)
Protein origin:Yeast
Protein region:1-518aa
Protein sequence:MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Information about sequence:Full Length
Expected molecular weight:58.72kDa
Protein purity:≥ 90%
Storage recommendation:Aliquot and store at -20°C. Minimize freezing and thawing.
Use before:1 year
Shipping requirements:Blue ice
Estimated production time:7-11 business days
Notes:For research use only. Not for diagnostic procedures.
Properties:Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source:Recombinants or rec. proteins
Group:recombinants

Other suggested products