Bioxys

Recombinant Human RuvB-like 2(RUVBL2)

Full list of all information from selected product

About product

Catalog number:RPC20342
Name:Recombinant Human RuvB-like 2(RUVBL2)
Size:500 μg
Price:1078.00
Go to shop   

Extra details

Verified reactivity:Homo sapiens (Human)
Protein number:Q9Y230
Gene number:RUVBL2
Other name:48 kDa TATA box-binding protein-interacting protein; Short name:; 48 kDa TBP-interacting protein; 51 kDa erythrocyte cytosolic protein; Short name:; ECP-51; INO80 complex subunit J; Repressing pontin 52; Short name:; Reptin 52; TIP49b; TIP60-associated protein 54-beta; Short name:; TAP54-beta
Protein origin:E.coli
Protein region:2-463aa
Protein sequence:ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
Information about sequence:Full Length
Expected molecular weight:66.99kDa
Protein purity:≥ 90%
Storage recommendation:Aliquot and store at -20°C. Minimize freezing and thawing.
Use before:1 year
Shipping requirements:Blue ice
Estimated production time:7-11 business days
Notes:For research use only. Not for diagnostic procedures.
Properties:Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source:Recombinants or rec. proteins
Group:recombinants

Other suggested products