Bioxys

MMP 1 (Interstitial Collagenase) (Native Protein)

Browse details of product

About product

Catalog number:30 101 002
Name:MMP 1 (Interstitial Collagenase) (Native Protein)
Size:10 µg/ 200µl
Price:340.00
Go to shop   

Extra details

Protein type:Native
Protein subtype:EC 3.4.24.7
Protein family:Matrix Metalloproteinases, matrixins
Protein description:MMP1 cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tats mediated neurotoxicity.
Research area interests:Diseases associated with MMP1 include Epidermolysis Bullosa Dystrophica, Ar and Pulmonary Disease, Chronic Obstructive. Among its related pathways are Pathways in cancer and PPAR signaling pathway.
Package form:liquid
Tested applications:Degaradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
Other names:Matrix Metalloproteinase 1, Fibroblast Collagenase
Peptide sequence:MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Available target modification:No
Expression system:Human Fibroblast
Product Subtype:full length
Active form?:Yes
Tag:untagged
Contents:50 mM Tris/HCl, pH 7.0, 300 mM NaCl, 5 mM CaCl2, 1 μM ZnCl2, 0.05% NaN3, 0.05% Brij 35.
Protein purity:>90%
Molecular weight:52-56 kDa
UniProt number:P03956
Gene number:4312
Abbreviation:MMP1
Full name:matrix metallopeptidase 1
Other desciption:Human MMP1 is isolated from human fibroblasts.
Purification:Mentioned in the data sheet
PubMed citations:See the data sheet
Warnings:For Research Use only.
Shipping conditions:dry ice
Storage condition:Store at -70°C
Technical datasheet:Contact us to receive the datasheet

Other suggested products