Bioxys

MMP 13 (Procollagenase 3), His-tagged (Recombinant Protein)

Detailed list of information related to product

About product

Catalog number:30 100 802
Name:MMP 13 (Procollagenase 3), His-tagged (Recombinant Protein)
Size:10 µg/ 50µl
Price:340.00
Go to shop   

Extra details

Protein type:Recombinant
Protein subtype:EC 3.4.24.35
Protein family:Matrix Metalloproteinases, matrixins
Protein description:MMP13 plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion
Research area interests:Diseases associated with MMP13 include Spondyloepimetaphyseal Dysplasia, Missouri Type and Metaphyseal Dysplasia, Spahr Type. Among its related pathways are Integrin Pathway and Development_Glucocorticoid receptor signaling.
Package form:liquid
Tested applications:Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
Other names:Matrix Metalloproteinase 13 (Procollagenase 3)
Peptide sequence:MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWCHHHHHH
Available target modification:No
Expression system:Insect Cell
Product Subtype:full length
Active form?:Yes, after APMA activation
Tag:His-tagged
Contents:50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35
Protein purity:>95%
Molecular weight:60 kDa
UniProt number:P45452
Gene number:4322
Abbreviation:MMP13
Full name:matrix metallopeptidase 13
Other desciption:Human recombinant procollagenase-3 is expressed in Sf9-insect cells using the baculovirus expression vector system and purified from cell culture supernatant.
Purification:Mentioned in the data sheet
PubMed citations:See the data sheet
Warnings:For Research Use only.
Shipping conditions:dry ice
Storage condition:Store at -70°C
Technical datasheet:Contact us to receive the datasheet
Conjugation:histidine
Source:Recombinants or rec. proteins
Group:recombinants

Other suggested products