Bioxys

MMP 14 (MT1-MMP) prodomain, catalytic domain, His-tagged (Recombinant Protein)

Detailed list of information related to product

About product

Catalog number:30 100 113
Name:MMP 14 (MT1-MMP) prodomain, catalytic domain, His-tagged (Recombinant Protein)
Size:200 µg/ 1 ml
Price:5005.00
Go to shop   

Extra details

Protein type:Recombinant
Protein subtype:EC 3.4.24.80
Protein family:Matrix Metalloproteinases, matrixins
Protein description:MMP14 seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2.
Research area interests:Diseases associated with MMP14 include Winchester Syndrome and Multicentric Osteolysis, Nodulosis, And Arthropathy. Among its related pathways are Signaling events mediated by focal adhesion kinase and Adhesion
Package form:liquid
Tested applications:Investigation of MT1-MMP; Generation of MT1-MMP catalytic domain; Progelatinase A activation; inhibitor screening; antigen standard;
Other names:Membrane-Type-1 Matrix Metalloproteinase
Peptide sequence:SLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGLVTHHHHHH
Available target modification:No
Expression system:E.coli
Product Subtype:protein fragment
Active form?:Yes
Tag:His-tagged
Contents:50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2.
Protein purity:> 90 %
Molecular weight:31 kDa
UniProt number:P50281
Gene number:4323
Abbreviation:MMP14 (partial)
Full name:matrix metallopeptidase 14 (partial)
Other desciption:Recombinant MT1-MMP prodomain-catalytic domain is produced as a periplasmic protein in E. coli.
Purification:Mentioned in the data sheet
PubMed citations:See the data sheet
Warnings:For Research Use only.
Shipping conditions:dry ice
Storage condition:Store at -70°C
Technical datasheet:Contact us to receive the datasheet
Conjugation:histidine
Source:Recombinants or rec. proteins
Group:recombinants

Other suggested products