Bioxys

alpha1- Antitrypsin (Native Protein)

View details of this awesome product

About product

Catalog number:30 900 105
Name:alpha1- Antitrypsin (Native Protein)
Size:1 mg lyophilized
Price:284.00
Go to shop   

Extra details

Protein type:Native
Protein subtype:N/A
Protein family:Inhibitor of serine proteases, Member of Serpin Family
Protein description:SERPIN1's primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin. Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).
Research area interests:Diseases associated with SERPINA1 include Emphysema Due To Aat Deficiency and Hemorrhagic Disease Due To Alpha-1-Antitrypsin Pittsburgh Mutation. Among its related pathways are Platelet activation, signaling and aggregation and FOXA1 transcription factor network.
Package form:liquid
Tested applications:inhibitor of proteases
Other names:Serpin Family A Member 1, Serpin Peptidase Inhibitor, Clade A,
Peptide sequence:MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Available target modification:No
Expression system:Human Blood
Product Subtype:full length
Active form?:Yes
Tag:untagged
Contents:50mM phosphate buffer pH 6.5; 100mM NaCl, without BSA and Azide
Protein purity:>95%
Molecular weight:54 kDa
UniProt number:P01009
Gene number:5265
Abbreviation:SERPINA1
Full name:serpin family A member 1
Other desciption:Purified from human serum.
Purification:Mentioned in the data sheet
PubMed citations:See the data sheet
Warnings:For Research Use only.
Shipping conditions:cool packs or dry ice
Storage condition:Store at -70°C
Technical datasheet:Contact us to receive the datasheet

Other suggested products